Prevotella melaninogenica: HMPREF0659_A5967 Help Entry HMPREF0659_A5967  CDS       T01286                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pmz  Prevotella melaninogenica Pathway pmz00020   Citrate cycle (TCA cycle) pmz01100   Metabolic pathways pmz01110   Biosynthesis of secondary metabolites pmz01120   Microbial metabolism in diverse environments pmz01200   Carbon metabolism pmz01210   2-Oxocarboxylic acid metabolism Module pmz_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pmz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HMPREF0659_A5967 Enzymes [BR:pmz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HMPREF0659_A5967 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_3 Fer4_8 Fer4_22 Fer4_13 Chordopox_G2 DUF326 Fer4_18 Motif Other DBs NCBI-ProteinID:  ADK95475 LinkDB All DBs Position I:complement(1211982..1212215) Genome browser AA seq 77 aa AA seqDB search MSKMKGAIVVNTDRCKGCQLCIVACPKDVIALAQKKVNVHGYPYTESARPDDCIGCAACA TVCPDGCITVYRKKVEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaaaggtgccattgtggtaaacacagatcgatgcaaaggatgccagttg tgtatcgttgcatgtccgaaagatgttattgctttggctcagaaaaaggttaatgtccac ggctatccgtatacagagtctgcacgaccagatgattgtattggttgtgctgcttgtgct acggtttgtcctgatggctgtatcacagtctatcgtaaaaaagtggaggaataa

DBGET integrated database retrieval system