Pseudomonas nunensis: NK667_05020 Help Entry NK667_05020       CDS       T08997                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pnb  Pseudomonas nunensis Pathway pnb00261   Monobactam biosynthesis pnb01100   Metabolic pathways pnb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NK667_05020  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pnb01008]     NK667_05020 Polyketide biosynthesis proteins [BR:pnb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NK667_05020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UTO15727 LinkDB All DBs Position 1093884..1094111 Genome browser AA seq 75 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLAYIEETWTDMRP LSLRQKMEEQAAVAH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccacgaagag caatactcgatctggcctgactacaaagccgtgccacaaggctggcgcaccgtgggcaag agcggcctgaagaaagaatgcctggcctatatcgaagaaacctggaccgacatgcgtccg ctgagcttgcgtcagaagatggaagagcaggcggcagtggctcactga

DBGET integrated database retrieval system