Pseudomonas aeruginosa NCGM2.S1: NCGM2_3417 Help Entry NCGM2_3417        CDS       T01974                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pnc  Pseudomonas aeruginosa NCGM2.S1 Pathway pnc00261   Monobactam biosynthesis pnc01100   Metabolic pathways pnc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NCGM2_3417  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pnc01008]     NCGM2_3417 Polyketide biosynthesis proteins [BR:pnc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NCGM2_3417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAK90265 LinkDB All DBs Position 1:complement(3692558..3692776) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system