Pseudomonas aeruginosa NCGM2.S1: NCGM2_5605 Help Entry NCGM2_5605        CDS       T01974                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pnc  Pseudomonas aeruginosa NCGM2.S1 Pathway pnc00790   Folate biosynthesis pnc01100   Metabolic pathways pnc01240   Biosynthesis of cofactors Module pnc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pnc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     NCGM2_5605 (folB) Enzymes [BR:pnc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      NCGM2_5605 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      NCGM2_5605 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      NCGM2_5605 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BAK92417 LinkDB All DBs Position 1:complement(5986638..5986967) Genome browser AA seq 109 aa AA seqDB search MEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGDDLALALDYAALSERVQEFARESH FQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPAARGVGVEIERGCR NT seq 330 nt NT seq  +upstreamnt  +downstreamnt ttggaggtcgataccgtcatcggcgtgtacgactgggagcgcggcatccgtcagtgcctg cgcctggacctgaccctgggctgggacaaccgtccggccgccgcgggcgacgatctcgcc ctggcgctggactatgccgcgttgtccgagcgggtgcaggaattcgcccgggaatcgcat ttccagttggtggaaaccttcgccgagcgcctcgccgaggtactgatgggcgagcgcggc attccctggctgcgcatccgcgtgaccaagcccggcgcggtgccggcggcccgtggcgtt ggcgtggagatcgaacgcggatgtcgctga

DBGET integrated database retrieval system