Parastagonospora nodorum: SNOG_07223 Help Entry SNOG_07223        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism pno  Parastagonospora nodorum Pathway pno03020   RNA polymerase pno03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pno00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SNOG_07223   09124 Replication and repair    03420 Nucleotide excision repair     SNOG_07223  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pno03021]     SNOG_07223    03400 DNA repair and recombination proteins [BR:pno03400]     SNOG_07223 Transcription machinery [BR:pno03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SNOG_07223   RNA polymerase III system    RNA polymerase III      SNOG_07223   RNA polymerase I system    RNA polymerase I      SNOG_07223 DNA repair and recombination proteins [BR:pno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SNOG_07223 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD HypA MCM_OB zf-CRD DUF951 Zn_Tnp_IS1595 zinc-ribbons_6 zinc_ribbon_13 DUF35_N zinc_ribbon_4 Motif Other DBs NCBI-GeneID:  5974462 NCBI-ProteinID:  XP_001797572 UniProt:  Q0ULZ1 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MSTQAYTTQTAADPTAIDASARTVHYKCGDCDQDVPLKRGEPIRCRNCGHRVLYKQRTNR NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgtccactcaagcctacaccacccaaaccgccgccgacccgaccgccatcgacgcctcg gcgcgcaccgtccactacaagtgcggcgactgcgaccaggacgtgccgctgaagcgcggc gagcccatccggtgccggaactgtggacatcgcgtgttgtacaagcagaggacgaatcgg tga

DBGET integrated database retrieval system