Pandoraea norimbergensis: AT302_20495 Help Entry AT302_20495       CDS       T04226                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pnr  Pandoraea norimbergensis Pathway pnr00261   Monobactam biosynthesis pnr01100   Metabolic pathways pnr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AT302_20495  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pnr01008]     AT302_20495 Polyketide biosynthesis proteins [BR:pnr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AT302_20495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALS61798 UniProt:  A0A0U2PEE2 LinkDB All DBs Position 2825794..2826042 Genome browser AA seq 82 aa AA seqDB search MSWDDENAEFEVVMNHEAQYSIWPSYKAIPGGWHAVGMKGNKAQCLAYIEEHWTDMRPLS LQKAMAEQAGQPASAGASASVH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagctgggacgacgaaaacgcagaattcgaagttgtgatgaaccacgaggcgcagtat tcgatctggccgagctacaaggccattccggggggctggcacgcggtcggcatgaagggc aacaaggcgcaatgcctggcctacatcgaggagcattggaccgacatgcgcccgctgagc ctgcaaaaggcaatggccgagcaggctggccagccggcgagtgccggtgcttctgcctcg gtgcactga

DBGET integrated database retrieval system