Pseudomonas nitroreducens: G5B91_18655 Help Entry G5B91_18655       CDS       T08828                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pnt  Pseudomonas nitroreducens Pathway pnt00261   Monobactam biosynthesis pnt01100   Metabolic pathways pnt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pnt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G5B91_18655  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pnt01008]     G5B91_18655 Polyketide biosynthesis proteins [BR:pnt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G5B91_18655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIE88181 UniProt:  A0A6G6J123 LinkDB All DBs Position complement(3898144..3898362) Genome browser AA seq 72 aa AA seqDB search MAFDREDAVYKVLVNGEEQYSLWPVYKEVPAGWREAGKQGSKADCLAFVEANWTDMRPLS LRQKMDGQAAGH NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggctttcgatcgcgaagacgcggtttacaaggtgctggtcaatggcgaagagcagtac tcgctgtggccggtctacaaggaagtcccggccggctggcgtgaggccggcaagcagggg agtaaggccgactgcctggccttcgtcgaagccaactggactgatatgcgcccgctgagc ctgcggcagaagatggacggccaggctgcggggcactga

DBGET integrated database retrieval system