Pseudodesulfovibrio nedwellii: SYK_01740 Help Entry SYK_01740         CDS       T09024                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pnw  Pseudodesulfovibrio nedwellii Pathway pnw00020   Citrate cycle (TCA cycle) pnw01100   Metabolic pathways pnw01110   Biosynthesis of secondary metabolites pnw01120   Microbial metabolism in diverse environments pnw01200   Carbon metabolism pnw01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pnw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SYK_01740 Enzymes [BR:pnw01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SYK_01740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_6 Fer4_17 Fer4_13 Fer4_22 Fer4_15 Fer4_3 ETF_QO Motif Other DBs NCBI-ProteinID:  BDQ35814 LinkDB All DBs Position 196470..196757 Genome browser AA seq 95 aa AA seqDB search MARKNKGKNKVTVYPDWCKGCGICVEFCPGKVLELNDQGKSSVVHEENCIRCGFCELHCP DFAIVVKDKDPESGKKAAKEAEFKAAKKNITGKGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctagaaaaaacaaagggaagaacaaggttaccgtgtacccggactggtgcaaaggc tgcggcatctgtgtcgagttttgtccgggcaaggtgcttgagttgaatgatcaagggaaa tcctcggttgttcacgaagagaactgtatccgttgcggcttttgcgagttgcactgtccc gattttgctatcgtggtcaaagacaaggatcccgagagcggcaaaaaggctgccaaggaa gcggaattcaaggctgccaaaaagaacataaccgggaagggggcgtaa

DBGET integrated database retrieval system