Pontibacillus sp. HMF3514: GS400_00525 Help Entry GS400_00525       CDS       T06374                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pof  Pontibacillus sp. HMF3514 Pathway pof00790   Folate biosynthesis pof01100   Metabolic pathways pof01240   Biosynthesis of cofactors Module pof_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pof00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GS400_00525 (folB) Enzymes [BR:pof01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GS400_00525 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GS400_00525 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GS400_00525 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB S-antigen Peptidase_S49 Costars Motif Other DBs NCBI-ProteinID:  QHE50656 UniProt:  A0A6P1HEC3 LinkDB All DBs Position 103023..103385 Genome browser AA seq 120 aa AA seqDB search MDKILMNQMTFYGYHGLFPEENKLGQRFVVDLELELDLKKAGETDDMNESVNYGHIYDET QKIVEGQAKQLVETVAEDIASTMLDTFQKVQAIKVKVIKPDPPIPGHYDSVAIEIYRERS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataaaatattaatgaatcagatgacattttacggctatcatggtttgttccctgaa gaaaataaattaggtcagcgttttgtcgtagatttagaacttgagttagacttgaaaaaa gcaggagagacagacgacatgaatgaaagtgtcaattatggccatatttacgatgaaacg cagaaaattgtggaaggtcaagcgaagcaactagtagaaacagtagctgaagatattgca tcaaccatgctagatacctttcaaaaagtacaagcaattaaggtgaaggtcattaagcca gaccctcctattcctggtcattacgactcggttgcgatcgaaatttatagggagagatca tag

DBGET integrated database retrieval system