Pontibacillus sp. ALD_SL1: IMZ31_00475 Help Entry IMZ31_00475       CDS       T09942                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pona  Pontibacillus sp. ALD_SL1 Pathway pona00790   Folate biosynthesis pona01100   Metabolic pathways pona01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:pona00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IMZ31_00475 (folB) Enzymes [BR:pona01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IMZ31_00475 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IMZ31_00475 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IMZ31_00475 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QST00154 LinkDB All DBs Position 95554..95922 Genome browser AA seq 122 aa AA seqDB search MDKILMKQMAFYGYHGLFPEENKLGQRFKVDLALELDLKEAGQTDNMEKSINYGRIYEVT KDVVEGEAKQLVETVAETIASELLARFDKLQACTVTVIKPDPPIPGHYESVAIEIYRERT TR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggataagatacttatgaagcagatggcattttacggctaccacggtttatttcctgaa gagaataaattggggcagcgctttaaagtggatcttgctttggagttagatttaaaggaa gcgggtcaaacggataatatggaaaagagtattaattatggccgcatttatgaggtgaca aaagatgtggttgaaggagaagccaagcaattagtagaaactgtggctgaaacaattgca tcagaattacttgcacgttttgataagcttcaagcttgtacggtgacggtaattaaaccg gacccacccataccgggtcactacgaatctgtggcaatcgaaatttatagggagcgaaca actagatga

DBGET integrated database retrieval system