Pseudomonas oryziphila: EJA05_16170 Help Entry EJA05_16170       CDS       T07791                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pory  Pseudomonas oryziphila Pathway pory00261   Monobactam biosynthesis pory01100   Metabolic pathways pory01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pory00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EJA05_16170  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pory01008]     EJA05_16170 Polyketide biosynthesis proteins [BR:pory01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EJA05_16170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZL69167 UniProt:  A0A3Q8U2J7 LinkDB All DBs Position complement(3472777..3472998) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIVFQVVINHEEQYSIWPDYKAIPNGWRAAGKSGLKQDCLAWIDEVWTDMRP LSLRQQMAAAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgacatcgtgttccaggtagtgatcaaccacgaagag caatattccatctggccagactacaaggccatccccaatggctggcgcgcggccggcaaa agcggcctgaagcaggactgcctggcctggatcgacgaagtctggaccgacatgcgcccg ctgagcctgcgccagcagatggccgcagccgccgcgcagtga

DBGET integrated database retrieval system