Pseudomonas paraeruginosa: B7D75_13175 Help Entry B7D75_13175       CDS       T08722                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppaa  Pseudomonas paraeruginosa Pathway ppaa00261   Monobactam biosynthesis ppaa01100   Metabolic pathways ppaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppaa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B7D75_13175  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppaa01008]     B7D75_13175 Polyketide biosynthesis proteins [BR:ppaa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B7D75_13175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVR67844 LinkDB All DBs Position 2751573..2751791 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcgggctaaagaaggactgcctggcctacatcgaggaggtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system