Panthera pardus (leopard): 109261932 Help Entry 109261932         CDS       T06062                                  Name (RefSeq) ferritin heavy chain-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ppad  Panthera pardus (leopard) Pathway ppad00860   Porphyrin metabolism ppad04216   Ferroptosis ppad04217   Necroptosis ppad04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ppad00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109261932  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109261932    04217 Necroptosis     109261932  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     109261932  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109261932 Enzymes [BR:ppad01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109261932 Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109261932   Exosomal proteins of bladder cancer cells    109261932 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  109261932 NCBI-ProteinID:  XP_019295887 Ensembl:  ENSPPRG00000012045 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK LATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPESGMAEYLFDKHTLGNSD NES NT seq 372 nt NT seq  +upstreamnt  +downstreamnt catgaggagagggaacatgctgagaaactgatgaagctgcagaaccaacgaggtggccga atcttccttcaggatatcaagaaaccagactgtgatgactgggagagcgggctgaatgca atggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaa ctggccactgacaaaaatgacccccatttgtgtgacttcattgagacgcattatctgaat gagcaggtgaaatccatcaaagaactgggtgaccacgtaaccaacctgcgcaagatgggg gctcccgaatctggcatggcagagtatctctttgacaagcacaccttgggaaacagtgat aacgagagctaa

DBGET integrated database retrieval system