Pseudomonas phytophila: K3169_08745 Help Entry K3169_08745       CDS       T09747                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppao  Pseudomonas phytophila Pathway ppao00261   Monobactam biosynthesis ppao01100   Metabolic pathways ppao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppao00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K3169_08745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppao01008]     K3169_08745 Polyketide biosynthesis proteins [BR:ppao01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K3169_08745 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UXZ97949 LinkDB All DBs Position 1953418..1953636 Genome browser AA seq 72 aa AA seqDB search MAFDREDALYKVLINQQEQYSLWPDYKAVPAGWREAGKQGSKADCLAYVEQVWTDMRPLS LRQKMDGQTEAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggcatttgatcgcgaagacgcgctgtacaaggttctgatcaatcagcaagaacagtat tcgctgtggcccgactacaaggccgtgccggccggctggcgtgaggcgggcaagcagggc agcaaggctgactgcctggcctacgtcgagcaggtctggaccgacatgcggcccctgagc ctgcggcaaaagatggacgggcagacggaggcgcgttaa

DBGET integrated database retrieval system