Pseudomonas putida BIRD-1: PPUBIRD1_1971 Help Entry PPUBIRD1_1971     CDS       T01975                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ppb  Pseudomonas putida BIRD-1 Pathway ppb00261   Monobactam biosynthesis ppb01100   Metabolic pathways ppb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PPUBIRD1_1971  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppb01008]     PPUBIRD1_1971 Polyketide biosynthesis proteins [BR:ppb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PPUBIRD1_1971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADR59619 LinkDB All DBs Position 2232127..2232348 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaatggctggcgagctgtgggcaaa agcggcctgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggctgaagctgccgcccagtga

DBGET integrated database retrieval system