Pseudomonas pergaminensis: KUA23_21330 Help Entry KUA23_21330       CDS       T08563                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppeg  Pseudomonas pergaminensis Pathway ppeg00261   Monobactam biosynthesis ppeg01100   Metabolic pathways ppeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppeg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KUA23_21330  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppeg01008]     KUA23_21330 Polyketide biosynthesis proteins [BR:ppeg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KUA23_21330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  USV99555 LinkDB All DBs Position complement(4732114..4732335) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEEVWTDMRP LSLRQKMDGATLA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctgtttcaggtagtggtcaaccatgaagaa cagtattccatctggcccgattacaaggctgtgccggaaggctggcgcaccgtgggaaag agcggcatgaagaaagagtgcctggcctacatcgaagaagtctggaccgatatgcgtcca ctgagcctgcgccagaagatggatggcgccacgctcgcttaa

DBGET integrated database retrieval system