Pyricularia pennisetigena: PpBr36_00722 Help Entry PpBr36_00722      CDS       T08194                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism ppei  Pyricularia pennisetigena Pathway ppei03020   RNA polymerase ppei03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ppei00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PpBr36_00722   09124 Replication and repair    03420 Nucleotide excision repair     PpBr36_00722  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ppei03021]     PpBr36_00722    03400 DNA repair and recombination proteins [BR:ppei03400]     PpBr36_00722 Transcription machinery [BR:ppei03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PpBr36_00722   RNA polymerase III system    RNA polymerase III      PpBr36_00722   RNA polymerase I system    RNA polymerase I      PpBr36_00722 DNA repair and recombination proteins [BR:ppei03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PpBr36_00722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  40730218 NCBI-ProteinID:  XP_029750785 LinkDB All DBs Position 2:2672547..2673019 Genome browser AA seq 78 aa AA seqDB search MIIPIRCFSCGKVTGDLWERFLNLIDSGMSDGDAMDALGCKRYCCRRMIMTHVDLIEKLL KYSTEGRHDKKMNLSHSS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgattattccgatccgatgcttctcctgtggcaaggtcactggcgacctctgggagcgt ttcctcaacctcatcgacagtggaatgtctgacggagatgctatggatgctcttggatgc aagaggtattgctgccgccgcatgatcatgacacacgttgatctgattgaaaagctgctc aaatactcgaccgaaggccgacatgacaagaagatgaacctgtcgcactcgtcatga

DBGET integrated database retrieval system