Pseudonocardia petroleophila: H6H00_21005 Help Entry H6H00_21005       CDS       T08626                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppel  Pseudonocardia petroleophila Pathway ppel00261   Monobactam biosynthesis ppel01100   Metabolic pathways ppel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppel00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H6H00_21005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppel01008]     H6H00_21005 Polyketide biosynthesis proteins [BR:ppel01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H6H00_21005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH TruB_C Motif Other DBs NCBI-ProteinID:  QNG50684 UniProt:  A0A7G7MD23 LinkDB All DBs Position 4217835..4218068 Genome browser AA seq 77 aa AA seqDB search MSTNPFDDPDGTFHALVNDEGQYSLWPVFVAVPQGWTVALGPAGRQECLDHIEAHWTDLR PRSLVAAMESDEQRTGD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccaccaacccgttcgacgaccccgacggcaccttccacgcgctcgtcaacgacgag ggccagtactcgctgtggcccgtgttcgtggcggtcccgcagggctggaccgtcgcgctg ggcccggccgggcgccaggagtgcctcgaccacatcgaggcgcactggaccgacctgcgc ccgcgcagcctcgtcgccgcgatggagtccgacgagcagcgcacgggcgactga

DBGET integrated database retrieval system