Pseudomonas putida F1: Pput_1961 Help Entry Pput_1961         CDS       T00537                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ppf  Pseudomonas putida F1 Pathway ppf00261   Monobactam biosynthesis ppf01100   Metabolic pathways ppf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pput_1961  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppf01008]     Pput_1961 Polyketide biosynthesis proteins [BR:ppf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pput_1961 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABQ78104 UniProt:  A5W1U4 LinkDB All DBs Position 2230747..2230968 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggccggactacaaagccatccccaacggctggcgagccgtgggcaaa agcggcctgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagctgccgcccagtga

DBGET integrated database retrieval system