Pseudomonas putida GB-1: PputGB1_2108 Help Entry PputGB1_2108      CDS       T00650                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ppg  Pseudomonas putida GB-1 Pathway ppg00261   Monobactam biosynthesis ppg01100   Metabolic pathways ppg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PputGB1_2108  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppg01008]     PputGB1_2108 Polyketide biosynthesis proteins [BR:ppg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PputGB1_2108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABY98009 UniProt:  B0KLN2 LinkDB All DBs Position 2361568..2361789 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaggccatccccaacggctggcgtgcggtgggcaag agcggcttgaagaaggactgcctggcctacatcgatgaggtctggaccgatatgcgcccg ctgagcttgcgccagaaaatggccgaagccgccgcccagtga

DBGET integrated database retrieval system