Pantoea phytobeneficialis: CTZ24_02550 Help Entry CTZ24_02550       CDS       T09899                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppho  Pantoea phytobeneficialis Pathway ppho00261   Monobactam biosynthesis ppho01100   Metabolic pathways ppho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppho00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CTZ24_02550  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppho01008]     CTZ24_02550 Polyketide biosynthesis proteins [BR:ppho01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CTZ24_02550 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QGR05345 LinkDB All DBs Position complement(571085..571306) Genome browser AA seq 73 aa AA seqDB search MEHRNPFDDPQQDCLVLRNPQQQYSLWPAFSALPAGWLAVYGPQPQPDCLNWLEQNWGNI RPVTQDTNRSDNV NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaacatcgcaatcccttcgacgatccgcagcaggattgtctggtgctgcgcaatccg cagcaacaatacagtttatggcccgcgttcagcgccctccccgctggctggctcgccgtg tatggcccgcagccacagcctgattgcctcaactggctggaacagaactgggggaatatc cgcccagtgacgcaggacaccaaccggagcgacaatgtctga

DBGET integrated database retrieval system