Pseudomonas putida ND6: YSA_05795 Help Entry YSA_05795         CDS       T02170                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ppi  Pseudomonas putida ND6 Pathway ppi00790   Folate biosynthesis ppi01100   Metabolic pathways ppi01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ppi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     YSA_05795 Enzymes [BR:ppi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      YSA_05795  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      YSA_05795  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      YSA_05795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFK69910 UniProt:  I3UWN9 LinkDB All DBs Position 3145215..3145562 Genome browser AA seq 115 aa AA seqDB search MFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAGDDLNLALDYASVSARIQAF AEQARFELVETFAERLVATLMDEFHIPWVRLKLTKPGAVPAARGGVGVEIERGCL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt gtgttcatcgaaggcctggaagtcgataccgttatcggtgcctatgactgggagcgggat attcgccagtgcttgcgcctggacctgagctttgcctgggacaaccgcccggccgccgcc ggagacgacctgaacctggcgctggattacgccagtgtgtcggcgcgcatccaggcgttt gccgaacaggcccgtttcgagctggttgaaacatttgccgagcgcctggtggccaccctg atggacgagttccacatcccttgggtgcgcttgaagctgaccaagccgggcgcggtgccg gcggcccgtggtggtgtaggcgtggagatcgagcgcggatgtctttga

DBGET integrated database retrieval system