Pseudomonas putida ND6: YSA_09290 Help Entry YSA_09290         CDS       T02170                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ppi  Pseudomonas putida ND6 Pathway ppi00261   Monobactam biosynthesis ppi01100   Metabolic pathways ppi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     YSA_09290  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppi01008]     YSA_09290 Polyketide biosynthesis proteins [BR:ppi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     YSA_09290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFK71793 UniProt:  I3V222 LinkDB All DBs Position 4989496..4989717 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaacggctggcgagccgtgggcaaa agcggcttgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagctgccgcccagtga

DBGET integrated database retrieval system