Pseudomonas piscis: QL104_21645 Help Entry QL104_21645       CDS       T09652                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppii  Pseudomonas piscis Pathway ppii00261   Monobactam biosynthesis ppii01100   Metabolic pathways ppii01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppii00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QL104_21645  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppii01008]     QL104_21645 Polyketide biosynthesis proteins [BR:ppii01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QL104_21645 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WMN15945 LinkDB All DBs Position complement(4674332..4674556) Genome browser AA seq 74 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGFKKDCLAYIEEVWTDMRP LSLRQKMDQQAVAG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacttccgtattcgaccgcgacgacatcctgttccaggtagtggtcaaccatgaagag caatactcgatctggcctgactacaaggctgtgccgcaaggctggcgcaccgtgggcaag agcggcttcaagaaagactgcctggcctatatagaggaagtctggaccgacatgcgcccc ttgagcctgcgccagaagatggatcagcaagcggttgccggttaa

DBGET integrated database retrieval system