Pleuronectes platessa (European plaice): 128458322 Help Entry 128458322         CDS       T09923                                  Symbol zgc:55558 Name (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04010   MAPK signaling pathway pplt04012   ErbB signaling pathway pplt04068   FoxO signaling pathway pplt04137   Mitophagy - animal pplt04140   Autophagy - animal pplt04150   mTOR signaling pathway pplt04210   Apoptosis pplt04218   Cellular senescence pplt04370   VEGF signaling pathway pplt04371   Apelin signaling pathway pplt04540   Gap junction pplt04625   C-type lectin receptor signaling pathway pplt04810   Regulation of actin cytoskeleton pplt04910   Insulin signaling pathway pplt04912   GnRH signaling pathway pplt04914   Progesterone-mediated oocyte maturation pplt04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pplt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128458322 (zgc:55558)    04012 ErbB signaling pathway     128458322 (zgc:55558)    04370 VEGF signaling pathway     128458322 (zgc:55558)    04371 Apelin signaling pathway     128458322 (zgc:55558)    04068 FoxO signaling pathway     128458322 (zgc:55558)    04150 mTOR signaling pathway     128458322 (zgc:55558)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128458322 (zgc:55558)    04137 Mitophagy - animal     128458322 (zgc:55558)   09143 Cell growth and death    04210 Apoptosis     128458322 (zgc:55558)    04218 Cellular senescence     128458322 (zgc:55558)   09144 Cellular community - eukaryotes    04540 Gap junction     128458322 (zgc:55558)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128458322 (zgc:55558)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128458322 (zgc:55558)   09152 Endocrine system    04910 Insulin signaling pathway     128458322 (zgc:55558)    04912 GnRH signaling pathway     128458322 (zgc:55558)    04914 Progesterone-mediated oocyte maturation     128458322 (zgc:55558)    04916 Melanogenesis     128458322 (zgc:55558)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pplt04131]     128458322 (zgc:55558)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pplt04031]     128458322 (zgc:55558) Membrane trafficking [BR:pplt04131]  Endocytosis   Macropinocytosis    Ras GTPases     128458322 (zgc:55558) GTP-binding proteins [BR:pplt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128458322 (zgc:55558) BRITE hierarchy Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin SatRNA_48 Sua5_yciO_yrdC Motif Other DBs NCBI-GeneID:  128458322 NCBI-ProteinID:  XP_053299083 EnsemblRapid:  ENSOESG00000019051 LinkDB All DBs Position 16:19336571..19340485 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL GTRNVESRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRKYKETNRSNKKSKKNT QKRRCLIL NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggggctggaggtgtggggaagagcgctctcacc atccagctcatccagaaccacttcgtagacgagtacgatccaaccatcgaggactcgtac agaaaacaggtggtgattgacggagagacgtgtctgctggacatcctggacacggcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggagagggcttcctctgc gtgttcgccatcaacaacatcaagtccttcgaggacgttcacctctacagagagcagatc aaccgggtgaaggacagtgacagcgtccccatggtgctggtggggaataagagcgacctg ggaacccgcaatgtggagtcgcgacaggcgcaggagctggcacgcagctacggagtgccg tttgtggagacctctgccaaaaccagacagggtgtggaggaagcgttctattcactggta cgggagattagaaaatacaaggagaccaaccgcagcaacaagaagagcaagaagaacact cagaagagacgttgtttgatactatag

DBGET integrated database retrieval system