Pseudomonas protegens CHA0: PFLCHA0_c42390 Help Entry PFLCHA0_c42390    CDS       T02671                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism pprc  Pseudomonas protegens CHA0 Pathway pprc00261   Monobactam biosynthesis pprc01100   Metabolic pathways pprc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pprc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PFLCHA0_c42390  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pprc01008]     PFLCHA0_c42390 Polyketide biosynthesis proteins [BR:pprc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PFLCHA0_c42390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGL85998 UniProt:  A0A2C9ER51 LinkDB All DBs Position complement(4792279..4792503) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGFKKDCLAYIEEVWTDMRP LSLRQKMDQQAVAG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgaccgtgaggacatcctgttccaggtggtggtcaaccatgaagag caatactcgatctggcccgactacaaggccgtgccccagggctggcgcactgtgggcaag agcggtttcaagaaggactgcctggcctacatcgaagaagtctggaccgacatgcggccc ttgagcctgcgccagaagatggaccagcaggccgtggccggctga

DBGET integrated database retrieval system