Pseudomonas promysalinigenes: HU725_009375 Help Entry HU725_009375      CDS       T07662                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pprg  Pseudomonas promysalinigenes Pathway pprg00261   Monobactam biosynthesis pprg01100   Metabolic pathways pprg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pprg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU725_009375  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pprg01008]     HU725_009375 Polyketide biosynthesis proteins [BR:pprg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU725_009375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI35517 LinkDB All DBs Position 2056619..2056840 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPEGWRAVGKRGLKQECLAYIDEVWTDMRP LSLRKQMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgtattcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatattccatctggccagactacaaggctatccctgaaggctggcgtgcagtgggcaag cgcggcctgaagcaggaatgtctggcgtatatcgacgaagtatggaccgacatgcgccca ttgagcctgcgcaagcagatggccgaagccgccgcccagtga

DBGET integrated database retrieval system