Pseudomonas psychrotolerans: BJP27_05425 Help Entry BJP27_05425       CDS       T05074                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ppsl  Pseudomonas psychrotolerans Pathway ppsl00261   Monobactam biosynthesis ppsl01100   Metabolic pathways ppsl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppsl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BJP27_05425  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppsl01008]     BJP27_05425 Polyketide biosynthesis proteins [BR:ppsl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BJP27_05425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APQ10967 LinkDB All DBs Position complement(1255054..1255269) Genome browser AA seq 71 aa AA seqDB search MAFDQEDATFKVLVNHEEQYSLWPDYKAVPAGWRETGTRGSKQECLDYVERTWTDMRPLS LRQAMDVQAGK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggcatttgatcaagaagacgcgaccttcaaggttctggtgaatcacgaggagcagtac tcgctgtggccggactacaaggcggtacccgccggttggcgcgagaccgggacgcgaggt tccaagcaggagtgccttgactacgtcgagcgcacctggaccgacatgcggccgctaagc ctgcgccaggccatggatgtccaggcgggcaaatga

DBGET integrated database retrieval system