Pseudomonas putida HB3267: B479_16220 Help Entry B479_16220        CDS       T02389                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism ppuh  Pseudomonas putida HB3267 Pathway ppuh00261   Monobactam biosynthesis ppuh01100   Metabolic pathways ppuh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppuh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B479_16220  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppuh01008]     B479_16220 Polyketide biosynthesis proteins [BR:ppuh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B479_16220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGA74136 LinkDB All DBs Position complement(3587911..3588132) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaacggctggcgtgccgtaggcaag agcggcctgaaaaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagccgccgcccagtga

DBGET integrated database retrieval system