Pseudomonas sp. UW4: PputUW4_01501 Help Entry PputUW4_01501     CDS       T02357                                  Symbol mbtH Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism ppuu  Pseudomonas sp. UW4 Pathway ppuu00261   Monobactam biosynthesis ppuu01100   Metabolic pathways ppuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppuu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PputUW4_01501 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppuu01008]     PputUW4_01501 (mbtH) Polyketide biosynthesis proteins [BR:ppuu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PputUW4_01501 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFY18706 UniProt:  K9NF76 LinkDB All DBs Position 1750866..1751093 Genome browser AA seq 75 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLAYIEETWTDMRP LSLRQKMDEQAAVAN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccatgaagag caatactcgatctggcccgattacaaagccgtaccacagggctggcgcaccgtgggtaaa agcgggctgaaaaaggaatgcctggcctatatcgaagagacctggactgacatgcgtccg ttgagcctgcgccagaagatggatgagcaggcggctgtggcgaactga

DBGET integrated database retrieval system