Pseudomonas putida DOT-T1E: T1E_2583 Help Entry T1E_2583          CDS       T02181                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ppx  Pseudomonas putida DOT-T1E Pathway ppx00261   Monobactam biosynthesis ppx01100   Metabolic pathways ppx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     T1E_2583  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppx01008]     T1E_2583 Polyketide biosynthesis proteins [BR:ppx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     T1E_2583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFO48425 UniProt:  I7B0A0 LinkDB All DBs Position complement(2829716..2829937) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaacggctggcgagccgtgggcaaa agcggcctgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagctgccgcccagtga

DBGET integrated database retrieval system