Pseudomonas poae: H045_12840 Help Entry H045_12840        CDS       T02456                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism ppz  Pseudomonas poae Pathway ppz00261   Monobactam biosynthesis ppz01100   Metabolic pathways ppz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H045_12840  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ppz01008]     H045_12840 Polyketide biosynthesis proteins [BR:ppz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H045_12840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGE26633 LinkDB All DBs Position complement(2967729..2967950) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGFKKECLAYIEETWTDMRP LSLRQKMDGVASV NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctgtttcaggtagtggtcaaccacgaagaa cagtattccatctggcctgactacaaagccgtaccggaaggctggcgcaccgtgggcaag agcggcttcaagaaagagtgcctggcctacatcgaagaaacctggaccgacatgcgcccg ttgagcctgcgccagaaaatggatggcgtcgcgtcggtctag

DBGET integrated database retrieval system