Pseudomonas qingdaonensis: KH389_09795 Help Entry KH389_09795       CDS       T07622                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pqi  Pseudomonas qingdaonensis Pathway pqi00261   Monobactam biosynthesis pqi01100   Metabolic pathways pqi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pqi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KH389_09795  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pqi01008]     KH389_09795 Polyketide biosynthesis proteins [BR:pqi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KH389_09795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QVL20848 LinkDB All DBs Position 2150264..2150488 Genome browser AA seq 74 aa AA seqDB search MTSVFDRDDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGLKAECLAYIDEVWTDMRP LSLRQKMAETAAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacttccgtattcgatcgcgacgatatcgtgttccaggttgtggtcaaccacgaggaa cagtactccatctggccggactacaaggctatccccaacggctggcgcaccgtcggcaag agcggtttgaaggctgagtgcctggcgtacatcgatgaggtatggaccgatatgcgcccg ctgagcctgcgccagaagatggccgaaaccgctgcggcgcagtga

DBGET integrated database retrieval system