Pieris rapae (cabbage white): 111003241 Help Entry 111003241         CDS       T05162                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism prap  Pieris rapae (cabbage white) Pathway prap04013   MAPK signaling pathway - fly prap04068   FoxO signaling pathway prap04137   Mitophagy - animal prap04140   Autophagy - animal prap04150   mTOR signaling pathway prap04213   Longevity regulating pathway - multiple species prap04214   Apoptosis - fly prap04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:prap00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     111003241    04068 FoxO signaling pathway     111003241    04150 mTOR signaling pathway     111003241  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111003241    04137 Mitophagy - animal     111003241   09143 Cell growth and death    04214 Apoptosis - fly     111003241  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     111003241   09149 Aging    04213 Longevity regulating pathway - multiple species     111003241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prap04131]     111003241   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:prap04031]     111003241 Membrane trafficking [BR:prap04131]  Endocytosis   Macropinocytosis    Ras GTPases     111003241 GTP-binding proteins [BR:prap04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111003241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  111003241 NCBI-ProteinID:  XP_022129338 LinkDB All DBs Position 5:3941510..3946288 Genome browser AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGSYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMTQAREVARSYGVPFVETSAKTRMGVDDAFYTLVREIRKDKESRGKKFRRGNKL GSRRSFKCTLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagttggttgtggttggtgctggaggcgtcggtaaatcagccttgact atacagctaatacagaatcacttcgtggacgagtatgaccctacgatagaagactcttat aggaagcaagtagtgatagatggagaaacttgcctgttggacatcttggacacggctgga caagaggagtattcagctatgagagatcagtacatgcgaactggtgaagggtttctgcta gtgtttgcagtgaacagtgctaagagttttgaggatatagggtcatacagggaacaaatt aaacgagtgaaggatgcagaagaagtaccaatggttttagttggaaataagtgtgatttg caagcctgggcggtggatatgacacaagcaagagaggttgcccgaagttatggcgtgcct tttgtagaaacttcagctaagacccgtatgggtgttgatgatgcattctacacactagtt agagagattcgcaaagataaagaaagccggggtaagaaatttaggcgaggaaataagtta ggttccaggcgttcctttaaatgtacactactttaa

DBGET integrated database retrieval system