Pradoshia sp. D12: F7984_00400 Help Entry F7984_00400       CDS       T06218                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism prd  Pradoshia sp. D12 Pathway prd00790   Folate biosynthesis prd01100   Metabolic pathways prd01240   Biosynthesis of cofactors Module prd_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:prd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     F7984_00400 (folB) Enzymes [BR:prd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      F7984_00400 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      F7984_00400 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      F7984_00400 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QFK69860 UniProt:  A0A5J6XJN8 LinkDB All DBs Position 79511..79885 Genome browser AA seq 124 aa AA seqDB search MDKIILENMEFYGYHGVYEEENKLGQRYRVSAELYMDLQVAGETDDLNKSVNYAEIYTLC KAIVEGKPYNLIEAVAEKISAEILGTYSIIHSCKIKVVKPDPPIPGHYDFVAVEIIREQE QHDE NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggataaaataattcttgaaaatatggaattttatggataccatggtgtttatgaagaa gaaaataagcttggacagcgttatagagtaagtgcagaattgtatatggatctgcaagtc gccggagaaacagatgatctgaataaatcggttaattatgctgaaatatacactttatgt aaggctattgtggaaggaaagccatataatctaatcgaagcagtggcagaaaagatatca gcagaaattttaggcacatattcaattattcattcatgcaaaatcaaggttgtgaaacca gacccaccgataccgggtcactacgattttgttgcagttgagattataagggagcaagag cagcatgatgaataa

DBGET integrated database retrieval system