Pseudomonas rhizosphaerae: LT40_02780 Help Entry LT40_02780        CDS       T03339                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism prh  Pseudomonas rhizosphaerae Pathway prh00190   Oxidative phosphorylation prh01100   Metabolic pathways prh02020   Two-component system Module prh_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:prh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     LT40_02780  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     LT40_02780 Enzymes [BR:prh01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      LT40_02780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AIS16382 UniProt:  A0A089YPW8 LinkDB All DBs Position 607262..607378 Genome browser AA seq 38 aa AA seqDB search MWYFAWILGVLLACSLGIINALWLEASNALDEEPVDER NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggattctgggtgtcctgctggcctgcagcctgggcatcatcaac gccctgtggctggaagcctccaacgcgctggacgaggaacctgtggatgaacgttga

DBGET integrated database retrieval system