Prevotella sp. oral taxon 299: HMPREF0669_00571 Help Entry HMPREF0669_00571  CDS       T02809                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pro  Prevotella sp. oral taxon 299 Pathway pro00020   Citrate cycle (TCA cycle) pro01100   Metabolic pathways pro01110   Biosynthesis of secondary metabolites pro01120   Microbial metabolism in diverse environments pro01200   Carbon metabolism pro01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pro00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HMPREF0669_00571 Enzymes [BR:pro01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HMPREF0669_00571 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_10 Fer4_9 Fer4_6 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_8 Fer4_3 Fer4_22 Fer4_13 Chordopox_G2 Motif Other DBs NCBI-ProteinID:  EFC71899 UniProt:  D3IAW7 LinkDB All DBs Position unnamed:complement(887781..888017) Genome browser AA seq 78 aa AA seqDB search MSKMKGAIVVDTDRCKGCMLCVVACPKDVISLTQNKVNVSGYSYAESIHPDDCVGCAACG IVCPDGCITVYRTKEEKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtaagatgaaaggtgccattgtagtggacactgatcgttgcaagggttgtatgctc tgcgtagttgcatgccctaaagacgtgatttcattaacacagaacaaggttaatgtttca ggctattcttatgctgaatccatacatcctgacgattgtgttggatgtgcagcatgtgga attgtgtgtcctgatggctgtataaccgtatacagaacaaaagaagagaaagggtaa

DBGET integrated database retrieval system