Phodopus roborovskii (desert hamster): 30213874 Help Entry 30213874          CDS       T08852                                  Symbol BOP69_gp09 Name (RefSeq) ATP synthase F0 subunit 8   KO K02125   F-type H+-transporting ATPase subunit 8 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob00190   Oxidative phosphorylation prob01100   Metabolic pathways prob04714   Thermogenesis prob05010   Alzheimer disease prob05012   Parkinson disease prob05014   Amyotrophic lateral sclerosis prob05016   Huntington disease prob05020   Prion disease prob05022   Pathways of neurodegeneration - multiple diseases prob05208   Chemical carcinogenesis - reactive oxygen species prob05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:prob00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     30213874 (BOP69_gp09)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     30213874 (BOP69_gp09)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     30213874 (BOP69_gp09)   09164 Neurodegenerative disease    05010 Alzheimer disease     30213874 (BOP69_gp09)    05012 Parkinson disease     30213874 (BOP69_gp09)    05014 Amyotrophic lateral sclerosis     30213874 (BOP69_gp09)    05016 Huntington disease     30213874 (BOP69_gp09)    05020 Prion disease     30213874 (BOP69_gp09)    05022 Pathways of neurodegeneration - multiple diseases     30213874 (BOP69_gp09)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     30213874 (BOP69_gp09)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:prob03029]     30213874 (BOP69_gp09) Mitochondrial biogenesis [BR:prob03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    F-type ATPase     30213874 (BOP69_gp09) BRITE hierarchy Motif Pfam:  ATP-synt_8 Motif Other DBs NCBI-GeneID:  30213874 NCBI-ProteinID:  YP_009316440 UniProt:  A0A342Z5C9 LinkDB All DBs Position MT AA seq 67 aa AA seqDB search MPQLDTSTWFVTVLASLITLFILMQLKVSSLNFYTNPSNKNINYLKSNNPWELKWTKIYL PLSLPLQ NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccacaactagacacatctacatgatttgttacagtcttagcctccttaatcacacta ttcatcttaatacaattgaaagtatcttcactaaatttctatacaaatccatctaacaaa aatatcaactacttaaaatcaaataacccttgagaactaaaatgaacgaaaatctatttg cctctttcattacccctacaataa

DBGET integrated database retrieval system