Propionimicrobium sp. PCR01-08-3: QQ658_02550 Help Entry QQ658_02550       CDS       T09133                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism prop  Propionimicrobium sp. PCR01-08-3 Pathway prop00400   Phenylalanine, tyrosine and tryptophan biosynthesis prop01100   Metabolic pathways prop01110   Biosynthesis of secondary metabolites prop01230   Biosynthesis of amino acids Module prop_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine prop_M00025   Tyrosine biosynthesis, chorismate => HPP => tyrosine Brite KEGG Orthology (KO) [BR:prop00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     QQ658_02550 Enzymes [BR:prop01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      QQ658_02550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  WIY83259 UniProt:  A0A9Y2RV74 LinkDB All DBs Position 523616..523930 Genome browser AA seq 104 aa AA seqDB search MTADQERAQSELLQLRSSIDNLDAALIHIMAERFKITQRVGRLKAEHRLPAADPAREAQQ IERMRGLARQSDLDPEFAEKLLNFIVREVVRHHLEIADEHAGSN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaccgccgatcaggagcgggctcagtccgagctgctgcagctacgcagcagcatcgac aatttggacgctgcgctgattcatatcatggccgagcgattcaagatcactcagcgggtg ggcaggctgaaggccgaacaccggcttcccgcggccgacccggcccgggaggcccagcaa atcgagcggatgcgtggcctggccagacagtccgacctcgatcccgaattcgccgagaaa ctgctcaacttcatcgtccgtgaggtcgtgcggcaccatctcgagatcgcggacgaacac gccggcagcaattag

DBGET integrated database retrieval system