Proteiniclasticum sp. QWL-01: P6M73_02595 Help Entry P6M73_02595       CDS       T08970                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism proq  Proteiniclasticum sp. QWL-01 Pathway proq00020   Citrate cycle (TCA cycle) proq01100   Metabolic pathways proq01110   Biosynthesis of secondary metabolites proq01120   Microbial metabolism in diverse environments proq01200   Carbon metabolism proq01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:proq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     P6M73_02595 Enzymes [BR:proq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      P6M73_02595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_6 Fer4_9 Fer4_16 Fer4_22 Fer4_3 Fer4_8 Fer4_17 Fer4_4 Fer4_13 Motif Other DBs NCBI-ProteinID:  WFF73357 LinkDB All DBs Position 553368..553577 Genome browser AA seq 69 aa AA seqDB search MPRVNFREDRCKGCGHCVTVCPVHIISFADRLNDKGYKPATIRPELMEQCIGCTSCARMC PDLCISVYK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgccaagagtgaatttcagggaagatcgctgcaagggttgcggtcactgtgtgacggtc tgtccggtgcacattatatcctttgctgaccggctcaacgacaagggatacaagccagcc accatccggccggaactgatggaacagtgcatcggctgcacatcctgtgcccgcatgtgt ccggatctttgtatttcagtgtataaatag

DBGET integrated database retrieval system