Pseudoalteromonas rubra: AT705_15750 Help Entry AT705_15750       CDS       T04179                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism prr  Pseudoalteromonas rubra Pathway prr00790   Folate biosynthesis prr01100   Metabolic pathways prr01240   Biosynthesis of cofactors Module prr_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:prr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AT705_15750 (folB) Enzymes [BR:prr01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AT705_15750 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AT705_15750 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AT705_15750 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ALU44280 UniProt:  A0A0U3HTK1 LinkDB All DBs Position 1:3634287..3634637 Genome browser AA seq 116 aa AA seqDB search MDTVYISQLHVETIIGVYDFEKESKQSLFFDIAMKTDISAAARQDDITLAVDYAKVSERV IAHTEASRVELLETLVEQLAAIILEEFAIEAVTIRVSKPAAVPQAQTVGLEITRNR NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacacggtctatatctcgcaattacacgtcgagaccataataggagtttacgacttt gaaaaagaaagtaaacaaagccttttctttgatatagcgatgaagactgatatctcggct gctgcgcgacaggatgacattacgctggctgtggattatgccaaagtcagtgagcgggtg attgcccatactgaggccagccgggttgagttacttgagacactggttgaacaactagct gccattattctagaagagtttgctattgaggctgtcacgattcgagtcagtaagccggct gccgttcctcaggcacaaactgttggcctggaaatcacgcggaatcgatag

DBGET integrated database retrieval system