Pseudomonas rhodesiae: HRH33_18965 Help Entry HRH33_18965       CDS       T07097                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism prx  Pseudomonas rhodesiae Pathway prx00261   Monobactam biosynthesis prx01100   Metabolic pathways prx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HRH33_18965  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:prx01008]     HRH33_18965 Polyketide biosynthesis proteins [BR:prx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HRH33_18965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QKJ74564 LinkDB All DBs Position complement(4200817..4201041) Genome browser AA seq 74 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPDGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMDGAALAG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctgtttcaggtagtggtcaaccatgaagaa cagtattccatctggcccgattacaaggccgtgccggacggctggcgtaccgtgggcaag agcggtttcaagaaagaatgcctggcctacatcgaagaagtctggaccgacatgcgtccg ttgagcctgcgccagaagatggatggcgcggcactggccggttga

DBGET integrated database retrieval system