Polymorphospora rubra: Prubr_36760 Help Entry Prubr_36760       CDS       T07190                                  Symbol mbtH_2 Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism pry  Polymorphospora rubra Pathway pry00261   Monobactam biosynthesis pry01100   Metabolic pathways pry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pry00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Prubr_36760 (mbtH_2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pry01008]     Prubr_36760 (mbtH_2) Polyketide biosynthesis proteins [BR:pry01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Prubr_36760 (mbtH_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ66655 UniProt:  A0A810N5A9 LinkDB All DBs Position 3911667..3911870 Genome browser AA seq 67 aa AA seqDB search MSTDTDLSTFAVVVNDEEQYSVWPAGRTLPAGWRETGFTGPRGACLAHVDEVWTDLRPKS LRQRMGA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgacaccgacctgtccacgttcgccgtcgtggtcaacgacgaggagcagtac tcggtctggccggccggccgtaccctgcccgccggctggcgggagaccgggttcaccggc ccgcgcggcgcctgcctggcgcacgtcgacgaggtctggaccgacctgcgcccgaagtcg ctccggcagcgcatgggcgcctga

DBGET integrated database retrieval system