Polymorphospora rubra: Prubr_41090 Help Entry Prubr_41090       CDS       T07190                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pry  Polymorphospora rubra Pathway pry00261   Monobactam biosynthesis pry01100   Metabolic pathways pry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pry00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Prubr_41090  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pry01008]     Prubr_41090 Polyketide biosynthesis proteins [BR:pry01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Prubr_41090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ67088 UniProt:  A0A810N5R1 LinkDB All DBs Position complement(4443137..4443346) Genome browser AA seq 69 aa AA seqDB search MDELEDRRLYHVVVNDEEQYSIWADGSEIPAGWRTAGFTGDRAACLAHIEQVWTDLRPRS LREWAASNA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacgaactcgaagaccgccgcctttaccacgtggtcgtcaatgacgaggagcagtac tcgatctgggccgacggatccgagatcccggccggatggcgcaccgccggatttaccggc gaccgcgccgcctgtctcgcccatatcgagcaggtctggaccgatctgcgtccgcgcagc cttcgggaatgggccgcgagcaacgcctga

DBGET integrated database retrieval system