Polymorphospora rubra: Prubr_63290 Help Entry Prubr_63290       CDS       T07190                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism pry  Polymorphospora rubra Pathway pry00261   Monobactam biosynthesis pry01100   Metabolic pathways pry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pry00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Prubr_63290  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pry01008]     Prubr_63290 Polyketide biosynthesis proteins [BR:pry01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Prubr_63290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ69308 UniProt:  A0A810NBT7 LinkDB All DBs Position 7075533..7075745 Genome browser AA seq 70 aa AA seqDB search MATNPFEDPDGTYVVLVNDEGQHSLWPDGLAVPAGWSVTRAATSRQECLQYVEENWTDMR PASLIRAMGG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggctaccaatccctttgaggaccctgacggcacgtacgttgtgctcgtcaacgacgag ggccagcactcgctctggccggacggcctggcggtaccggcgggctggtcggtgacgcgg gcggcgacctcccgccaagagtgcctgcagtacgtcgaggagaactggacggacatgcgg ccggcgtcgctgatccgcgcgatgggtggctga

DBGET integrated database retrieval system