Polymorphospora rubra: Prubr_65190 Help Entry Prubr_65190       CDS       T07190                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism pry  Polymorphospora rubra Pathway pry00261   Monobactam biosynthesis pry01100   Metabolic pathways pry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pry00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Prubr_65190  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pry01008]     Prubr_65190 Polyketide biosynthesis proteins [BR:pry01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Prubr_65190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ69498 UniProt:  A0A810NCB4 LinkDB All DBs Position complement(7313339..7313548) Genome browser AA seq 69 aa AA seqDB search MTNPFEDPDGRYLVLVNDEGQHSLWPTFVDVPDGWRTVFGEDGRQECLDYIEQNWTDLRP KSLIEAMGR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgacgaatccgttcgaggaccccgacggccgctatctggtcctggtcaacgacgaggga cagcactctctgtggcccaccttcgtcgacgtgccggacggctggcggaccgtgttcggc gaggacgggcgccaggagtgcctcgactacatcgagcagaactggaccgatctgcggccg aagagcctcatcgaggccatgggcaggtag

DBGET integrated database retrieval system