Stutzerimonas stutzeri A1501: PST_0717 Help Entry PST_0717          CDS       T00511                                  Symbol folB-1 Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism psa  Stutzerimonas stutzeri A1501 Pathway psa00790   Folate biosynthesis psa01100   Metabolic pathways psa01240   Biosynthesis of cofactors Module psa_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:psa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PST_0717 (folB-1) Enzymes [BR:psa01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PST_0717 (folB-1)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PST_0717 (folB-1)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PST_0717 (folB-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABP78422 UniProt:  A4VHH1 LinkDB All DBs Position 819946..820299 Genome browser AA seq 117 aa AA seqDB search MDTVFIEGLEVDTVIGAYDWERGIRQCLQLDLALGWDIRPAARNDELDKALDYAKVAAAI DQFAAEARFELVETFAERLAQRLMSEFGIVWLRLRVTKPGVNARARALGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggatacagtcttcatcgaaggcctggaagtggatacggtgatcggcgcctatgattgg gagcgcggcatccggcagtgcctgcagttggacctggcgctgggctgggacatccgtccg gcggcgcggaacgacgagctggacaaggcgctggactacgccaaggtcgctgcggccatc gaccagttcgctgccgaggcgcgcttcgagttggtagagaccttcgccgagcgcctggcg cagcgtctgatgagcgagttcggcatcgtctggctgcgcctgcgggtcaccaagcctggc gtcaatgcgcgcgcccgcgcgctgggcgtggagatcgaacgcggatgtcgctga

DBGET integrated database retrieval system