Pseudomonas salmasensis: HU731_006945 Help Entry HU731_006945      CDS       T07619                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism psam  Pseudomonas salmasensis Pathway psam00261   Monobactam biosynthesis psam01100   Metabolic pathways psam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psam00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU731_006945  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psam01008]     HU731_006945 Polyketide biosynthesis proteins [BR:psam01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU731_006945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH79530 UniProt:  A0AA92MXY3 LinkDB All DBs Position complement(1597415..1597639) Genome browser AA seq 74 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEDVWTDMRP LSLRQKMDGAALAN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctctttcaggtagtggtcaaccatgaagaa cagtattcgatctggcccgactacaaggccgtgccagaaggctggcgcaccgtgggcaag agcggcatgaagaaagaatgcctggcctacatcgaggacgtgtggaccgacatgcgcccg ctgagcctgcgccagaaaatggatggcgcggccctcgccaactga

DBGET integrated database retrieval system