Paracoccus saliphilus: JHX88_14560 Help Entry JHX88_14560       CDS       T08849                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism psap  Paracoccus saliphilus Pathway psap00260   Glycine, serine and threonine metabolism psap01100   Metabolic pathways Module psap_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:psap00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     JHX88_14560 Enzymes [BR:psap01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      JHX88_14560     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      JHX88_14560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  WCR02117 LinkDB All DBs Position complement(3028916..3029176) Genome browser AA seq 86 aa AA seqDB search MKQLNCPVNGLRDISEFQYLGPKRATDPENAETVVRHVFFVENPIGPMVEWWRHRPSNTV FLAERHTATDHFIRTWLPDGPEDTNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaacaactgaactgcccggtgaacgggctgcgcgacatttccgagttccagtatctc ggaccgaagcgcgcgaccgatcccgagaatgccgaaaccgtggtgcgccatgtcttcttc gtcgagaacccgatcggcccgatggttgagtggtggcggcaccggccgagcaacacggtt tttcttgcggaacgtcacactgccaccgaccacttcatccgcacatggctccccgacggg ccggaggataccaatgcctga

DBGET integrated database retrieval system