Pseudomonas syringae pv. syringae B728a: Psyr_1947 Help Entry Psyr_1947         CDS       T00246                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism psb  Pseudomonas syringae pv. syringae B728a Pathway psb00261   Monobactam biosynthesis psb01100   Metabolic pathways psb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Psyr_1947  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:psb01008]     Psyr_1947 Polyketide biosynthesis proteins [BR:psb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Psyr_1947 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AAY36990 UniProt:  Q4ZV32 LinkDB All DBs Position 2232440..2232658 Genome browser AA seq 72 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQTA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgggaagacatcgtctttcaagttgtagtcaaccacgaagaa cagtattccatctggcccgactacaaggcgatccccaatggctggcgcaccgtgggcaag agcggcttcaagaaagaatgcctggcctacatcgaagaagtctggaccgacatgcgcccc ctgagcctgcgccagaaaatggaagcgcagacggcctga

DBGET integrated database retrieval system